PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000918566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 228aa    MW: 25675.2 Da    PI: 4.5559
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000918566genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM97.32.4e-30341661128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknr.atksgyWkatgkdkev 92 
                    lp G+rF+Pt +e++v+yL +k+ ++ +++ + ikevd+y++ P++Lp+   +++a+ +  y+F++r+   a++ +  + at+ gyWk    ++ev
  MDP0000918566  34 LPLGYRFDPTGDEILVYYLFNKIMDRAMPTYDLIKEVDVYECXPNQLPNgdfRHTADFNAAYYFANREPFDAREGKIIKtATDGGYWKVIDDEEEV 129
                    699*********************************************5455555566688*******9999866666659**************9 PP

            NAM  93 lsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    l k ++  vg  +++ fykg+ap+g+kt  vm+eyrl
  MDP0000918566 130 LFKdSDVIVGFETVMKFYKGQAPNGTKTPFVMNEYRL 166
                    998466679**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-3331195IPR003441NAC domain
PROSITE profilePS5100534.934195IPR003441NAC domain
PfamPF023658.6E-1535166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MASSASQSAD ENEGFDLLKC STVQEGXKDA EIRLPLGYRF DPTGDEILVY YLFNKIMDRA  60
MPTYDLIKEV DVYECXPNQL PNGDFRHTAD FNAAYYFANR EPFDAREGKI IKTATDGGYW  120
KVIDDEEEVL FKDSDVIVGF ETVMKFYKGQ APNGTKTPFV MNEYRLNPRV VPAHVLNESI  180
KTKIERYVVC RIINKEVSNQ PAIDYGQGLL XLLQKSSAGT VEDGVPK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-20232006170NAC domain-containing protein 19
4dul_A4e-20232006170NAC domain-containing protein 19
1ut7_B4e-20232006170NO APICAL MERISTEM PROTEIN
1ut7_A4e-20232006170NO APICAL MERISTEM PROTEIN
1ut4_B4e-20232006170NO APICAL MERISTEM PROTEIN
1ut4_A4e-20232006170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981260.0KF198126.1 Malus hupehensis NAC domain protein (NAC119) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339823.11e-167PREDICTED: NAC transcription factor 29-like
RefseqXP_008361771.11e-167PREDICTED: NAC transcription factor 29-like
TrEMBLS5RSJ31e-124S5RSJ3_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15772611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.24e-25NAC domain containing protein 38